Skip to main content
Home
Toggle menu

  • Home

Paramount+


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

Paramount+

Evil Is Over, but Evil Will Live Forever

Thu, 08/22/2024 - 10:30
Gizmodo

Evil Finale Recap Top Art

horror, evil, Paramount+, Satan, tv recap

What Is G.I. Joe’s Problem at the Movies?

Wed, 08/07/2024 - 10:15
Gizmodo

Snake Eyes Gijoe

Sci-Fi, G.I. Joe, G.I. Joe: Retaliation, G.I. Joe: Rise of Cobra, hasbro, Paramount+, Snake Eyes

Star Trek: Lower Decks Season 5’s First Trailer Is the Beginning of the End

Sat, 07/27/2024 - 17:25
Gizmodo

Star Trek Lower Decks Season 5 Trailer

Trailer Frenzy, Paramount+, San Diego Comic-Con, sdcc, SDCC 2024, Star Trek, Star Trek: Lower Decks

Tales of the Teenage Mutant Ninja Turtles‘ Opening Sequence Is an Artistic Blast

Thu, 07/25/2024 - 18:15
Gizmodo

Tales Of The Tmnt Title Sequence

Trailer Frenzy, Paramount+, San Diego Comic-Con, sdcc, SDCC 2024, tales of the teenage mutant ninja turtles, teenage mutant ninja turtles

Evil‘s Christine Lahti on Sheryl’s Wonderfully Wicked Journey

Thu, 07/25/2024 - 17:00
Gizmodo

Christine Lahti in Evil

horror, christine lahti, evil, Paramount+, Satan

Evil‘s Andrea Martin on Acting With Demons and the Terror of AI

Thu, 07/18/2024 - 15:45
Gizmodo

Andrea Martin as Sister Andrea on Evil

horror, io9, Television, andrea martin, evil, Paramount+

In This Exclusive Evil Clip, AI Bedevils a Priest From Beyond the Grave

Wed, 07/17/2024 - 16:00
Gizmodo

Andrea Martin as Sister Andrea and Wallace Shawn as Father Ignatius appearing in Evil episode 9, season 4, streaming on Paramount+.

horror, io9, Television, aasif mandvi, andrea martin, Chatbots, evil

This Week’s Evil Revealed What Happens if You Baptize the Antichrist

Fri, 07/12/2024 - 12:00
Gizmodo

horror, io9, Television, antichrist, evil, Paramount+, Satan

Paramount Has Been Assimilated by Skydance Media in $8 Billion Takeover

Mon, 07/08/2024 - 10:00
Gizmodo

Corporate Culture, io9, Paramount+, skydance, Star Trek

Pagination

  • Previous page ‹‹
Subscribe to Paramount+
sfy39587stp18