Skip to main content
Home
Toggle menu

  • Home

SDCC 2024


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

SDCC 2024

The Vaunted Schumacher Cut of Batman Forever Could Still See the Light of Day

Fri, 07/26/2024 - 10:45
Gizmodo

Batman Forever Val Kilmer

dc universe, akiva goldsman, batman, batman forever, joel schumacher, Man-Bat, San Diego Comic-Con

The Future of Star Wars‘ New Books and Comics Lies in the Shadow of The Acolyte

Thu, 07/25/2024 - 20:20
Gizmodo

High Republic SDCC

Star Wars, San Diego Comic-Con, sdcc, SDCC 2024, star wars outlaws, Star Wars: The High Republic, the acolyte

DC’s Absolute Batman Is an Absolute Unit

Thu, 07/25/2024 - 19:00
Gizmodo

Absolute Batman

DC Comics, batman, DC Comics, San Diego Comic-Con, sdcc, SDCC 2024, superman

Tales of the Teenage Mutant Ninja Turtles‘ Opening Sequence Is an Artistic Blast

Thu, 07/25/2024 - 18:15
Gizmodo

Tales Of The Tmnt Title Sequence

Trailer Frenzy, Paramount+, San Diego Comic-Con, sdcc, SDCC 2024, tales of the teenage mutant ninja turtles, teenage mutant ninja turtles

Lego’s Dungeons & Dragons Collectible Minifigures Look Absolutely Amazing

Thu, 07/25/2024 - 17:30
Gizmodo

Lego Dungeons & Dragons Minifigures

Toys and Collectibles, Dungeons & Dragons, lego, San Diego Comic-Con, sdcc, SDCC 2024

Transformers One‘s New Trailer Shows Optimus Prime and Megatron’s Doomed Friendship

Thu, 07/25/2024 - 16:03
Gizmodo

Transformers One Optimus Prime

Trailer Frenzy, San Diego Comic-Con, sdcc, SDCC 2024, transformers, transformers one

The 15 Coolest Things at San Diego Comic-Con (So Far)

Thu, 07/25/2024 - 13:00
Gizmodo

Comic Con preview night

Toys and Collectibles, San Diego Comic-Con, sdcc, SDCC 2024

SDCC’s Pop-Up Activations Bring Apes, Pizza, Pirates, and More

Thu, 07/25/2024 - 12:00
Gizmodo

Adult Swim Pirate Party at SDCC

io9, Adult Swim, kingdom of the planet of the apes, Rick and Morty, San Diego Comic-Con, sdcc, SDCC 2024

Lego Minecraft‘s Comic-Con Reveal Is a Party

Wed, 07/24/2024 - 20:30
Gizmodo

Sdfgoihdofigh

Toys and Collectibles, lego, minecraft, San Diego Comic-Con, sdcc, SDCC 2024

10 Things We’re Sad Won’t Be at Comic-Con This Year

Tue, 07/23/2024 - 15:30
Gizmodo

Wicked, Severance, Superman

io9, Movies, Television, evil, San Diego Comic-Con, sdcc, SDCC 2024

Pagination

  • Previous page ‹‹
  • Next page ››
Subscribe to SDCC 2024
sfy39587stp18