Skip to main content
Home
Toggle menu

  • Home

Trailer Frenzy


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

Trailer Frenzy

Get Ready for More Public Domain Slashers in 2025

Sun, 09/01/2024 - 16:00
Gizmodo

Neverland Screamboat

Trailer Frenzy, peter pan, Peter Pan's Neverland Nightmare, public domain, Screamboat, steamboat willie

Apartment 7A‘s First Trailer Digs Into a Satanic Horror Backstory

Thu, 08/29/2024 - 12:00
Gizmodo

Julia Garner In Apartment7a

Trailer Frenzy, apartment 7a, Paramount+, Rosemary's Baby

Sonic the Hedgehog 3‘s Trailer Is Finally Here

Tue, 08/27/2024 - 09:01
Gizmodo

Sonic 3 Trailer Shadow

Trailer Frenzy, Keanu Reeves, shadow the hedgehog, sonic the hedgehog

DC’s Christopher Reeve Documentary Looks Heroically Heartbreaking

Mon, 08/26/2024 - 10:20
Gizmodo

Trailer Frenzy, christopher reeve, DC Studios, Super/Man: The Christopher Reeve Story, superman, Warner Bros.

War of the Rohirrim‘s First Trailer Is a Rallying Return to Peter Jackson’s Middle-earth

Thu, 08/22/2024 - 15:00
Gizmodo

Lord Of The Rings War Of The Rohirrim Hera Anime

Trailer Frenzy, Anime, kenji kamiyama, Lord of the Rings, War of the Rohirrim, Warner Bros.

Star Wars Outlaws’ Launch Trailer Teases Smuggling Adventure and a Rancor Fight

Thu, 08/22/2024 - 11:30
Gizmodo

Star Wars Outlaws Launch Trailer Rancor Fight

Trailer Frenzy, Massive Entertainment, Star Wars, star wars outlaws, ubisoft

Megalopolis‘s New Trailer Prepares You for a Critical Backlash

Wed, 08/21/2024 - 11:50
Gizmodo

Megalopolis Adam Driver

Trailer Frenzy, Adam Driver, Aubrey Plaza, francis ford coppola, giancarlo esposito, megalopolis, Wow Platinum

New Sci-Fi Comedy Y2K Looks Hilarious, Violent, and Awesome

Tue, 08/20/2024 - 09:00
Gizmodo

Y2k 2024 Movie

Trailer Frenzy, A24, jaeden martell, julian dennison, Kyle Mooney, rachel zegler, Y2K

The Legend of Lara Croft‘s New Trailer Gets Everyone on Lara’s Back

Mon, 08/19/2024 - 14:00
Gizmodo

Tomb Raider Legend Of Lara Croft Lara Lava

Trailer Frenzy, hayley atwell, lara croft, netflix, tomb raider

Kaos‘ New Trailer Is Full of Campy, Desperate Immortals

Mon, 08/19/2024 - 12:50
Gizmodo

Jeff Goldblum As Zeus In Kaos

Trailer Frenzy, billie piper, Charlie Covell, Debi Mazar, Greek mythology, Janet McTeer, Jeff Goldbum

Pagination

  • Previous page ‹‹
  • Next page ››
Subscribe to Trailer Frenzy
sfy39587stp18