Skip to main content
Home
Toggle menu

  • Home

the dark tower


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

the dark tower

Our Latest Hint For the Identity of Deadpool & Wolverine‘s Lady Deadpool

Tue, 07/23/2024 - 10:00
Gizmodo

io9, Morning Spoilers, Deadpool & Wolverine, evil, i know what you did last summer, rebel moon, spawn

Lego's Lord of the Rings Barad-Dûr Set Is Just About Worthy of a Dark Lord

Wed, 05/29/2024 - 15:45
Gizmodo

Last year, Lego returned after years away to the realm of Middle-earth, delivering one of the most remarkable sets it’s ever made in in Rivendell, a gorgeous tribute

barad dur, Lord of the Rings, windows games, gothmog, battle of the morannon, aragorn, The Lord of the Rings

Lego's Lord of the Rings Barad-Dûr Set Will Cast an Evil Eye Over Your Domain

Tue, 05/14/2024 - 09:00
Gizmodo

The last time Lego ventured there and back again to its Lord of the Rings line, we found ourselves at the House of Elrond, a bastion of all that is good in Middle-e

lego, barad dur, barad, lego minifigure, The Lord of the Rings, lego the lord of the rings, sauron
Subscribe to the dark tower
sfy39587stp18