Skip to main content
Home
Toggle menu

  • Home

david callaham


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

david callaham

The He-Man Movie Swears It's Alive and That This Is Your Actual He-Man This Time

Wed, 05/29/2024 - 13:00
Gizmodo

The on-again, off-again live-action Masters of the Universe movie reassured fans back in February that plans were still underway to create a new tale inspired by

amazon, entertainment culture, nicholas galitzine, fictional cyborgs, skeletor, david callaham, aaron nee

Godzilla x Kong's Follow Up is a-Go, and Shang-Chi's David Callaham is Writing It

Sat, 05/11/2024 - 14:40
Gizmodo

It’s been over a month since Godzilla x Kong: The New Empire came out, and once the credits rolled, discussion pivoted to what was coming next. Were Warner Bros.

david callaham, godzilla, shang chi, chi, godzilla films, spider man, entertainment culture

The Master of the Universe Movie Is Back On, Again

Tue, 02/13/2024 - 17:30
Gizmodo

It seems that by the power of Greyskull, the Master of the Universe movie is back on!

dc universe, amazon, masters of the universe, entertainment culture, hailee steinfeld, laika, aaron

Watch Spider-Man: Across the Spider-Verse's Riveting Ghost Spider Opening

Wed, 08/09/2023 - 13:35
Gizmodo

Get hooked back into the Spider-Verse with the opening sequence from the hit Sony Pictures Animation superhero film.

Read more...

spider verse, spider man across the spider verse, spider man, prowler, issac, joaquim dos santos, brown
Subscribe to david callaham
sfy39587stp18