Skip to main content
Home
Toggle menu

  • Home

health inspection


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

health inspection

MSC cruise ship fails health inspection with the lowest score in years after CDC finds a door handle covered in hamburger blood and yogurt containers with 'black filth residue'

Tue, 05/09/2023 - 12:40
Tech Insider : Travel
MSC Seaside cruise ship arrives at the Port of Marseille.
MSC Seaside cruise ship arrives at the Port of Marseille.

Gerard Bottino/SOPA Images/LightRocket via Getty Images

Transportation, MSC Cruises, Cruise, Center for Disease Control (CDC), health inspection, Travel, Cruise Lines
Subscribe to health inspection
sfy39587stp18