Skip to main content
Home
Toggle menu

  • Home

Hybrid solar eclipse


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

Hybrid solar eclipse

How to watch today's hybrid solar eclipse — the rarest type of eclipse — even if you don't live near Australia where it's happening

Wed, 04/19/2023 - 14:57
Tech Insider
Sequence of the 2019 annular solar eclipse.
Hybrid eclipses are the most rare type of solar eclipse there is.

goh keng cheong / Getty Images

Science, News, Solar Eclipse, NASA, Hybrid solar eclipse, Speed desk, Space
Subscribe to Hybrid solar eclipse
sfy39587stp18