Skip to main content
Home
Toggle menu

  • Home

jake johnson


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

jake johnson

Watch Spider-Man: Across the Spider-Verse's Riveting Ghost Spider Opening

Wed, 08/09/2023 - 13:35
Gizmodo

Get hooked back into the Spider-Verse with the opening sequence from the hit Sony Pictures Animation superhero film.

Read more...

spider verse, spider man across the spider verse, spider man, prowler, issac, joaquim dos santos, brown

Spider-Man: Across the Spider-Verse Is Swinging Into Homes Soon

Tue, 08/01/2023 - 19:15
Gizmodo

The wait till Spider-Man: Beyond The Spider-Verse is going to be a long one, but starting August 8 you’ll be able to revisit Spider-Man: Across the Spider-Verse any time you want.

spider verse, spider man, miles morales, entertainment culture, hailee steinfeld, the amazing spider man 2, imax films
Subscribe to jake johnson
sfy39587stp18