Skip to main content
Home
Toggle menu

  • Home

jamie bailey


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

jamie bailey

Mickey Mouse Horror Movie Makers Are as Cynical as You'd Expect

Mon, 01/08/2024 - 15:15
Gizmodo

It was inevitable that once Mickey Mouse entered the public domain via early Disney short Steamboat Willie, projects exploiting the icon’s newly accessible status

Mickey Mouse, mickey, jamie bailey, alex, entertainment culture, winnie the pooh, mickey mouse trap

Of Course the First Steamboat Willie Horror Movie Is Already Here

Tue, 01/02/2024 - 11:15
Gizmodo

The start of 2024 saw a major milestone in U.S.

steamboat willie, willie, jamie bailey, alex, entertainment culture, trap, aa milne
Subscribe to jamie bailey
sfy39587stp18