Skip to main content
Home
Toggle menu

  • Home

justin k thompson


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

justin k thompson

Watch Mind-Blowing Spider-Man: Across the Spider-Verse Art Come to Life

Tue, 03/05/2024 - 12:15
Gizmodo

Spider-Man: Across the Spider-Verse was already a work of art—but now, it’s a work of art in a whole new way.

spider, spider verse, spider man, miles morales, entertainment culture, justin k thompson, chris miller

Spider-Man: Across the Spider-Verse Invented a New Ending Weeks Before Release

Mon, 02/26/2024 - 13:00
Gizmodo

Just a few weeks before release, Spider-Man: Across the Spider-Verse had a different ending. That original ending is still in the movie, but now it comes a few seconds earlier.

spider verse, spider man, spider man across the spider verse, luke, mac gargan, spider woman, star wars episode v the empire strikes back

Check Out This Year's Harvey Award Nominees

Fri, 08/11/2023 - 09:00
Gizmodo

The year 2023 marks the 35th anniversary of the Harvey Awards, one of the most prestigious ceremonies in comics—and a celebration of the myriad forms they’ve insp

eisner award for best lettering, jacob phillips, ed brubaker, tatsuki fujimoto, entertainment culture, benji nate, montana kane

Watch Spider-Man: Across the Spider-Verse's Riveting Ghost Spider Opening

Wed, 08/09/2023 - 13:35
Gizmodo

Get hooked back into the Spider-Verse with the opening sequence from the hit Sony Pictures Animation superhero film.

Read more...

spider verse, spider man across the spider verse, spider man, prowler, issac, joaquim dos santos, brown
Subscribe to justin k thompson
sfy39587stp18