Skip to main content
Home
Toggle menu

  • Home

mordor


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

mordor

Breaking Down the Binding Darkness of Rings of Power Season 2's Trailer

Tue, 05/14/2024 - 14:15
Gizmodo

This morning Amazon’s Prime Video gave us our first look at

rings of power, elder, sam hazeldine, narya, The Lord of the Rings, sauron, robert aramayo

Lego's Lord of the Rings Barad-Dûr Set Will Cast an Evil Eye Over Your Domain

Tue, 05/14/2024 - 09:00
Gizmodo

The last time Lego ventured there and back again to its Lord of the Rings line, we found ourselves at the House of Elrond, a bastion of all that is good in Middle-e

lego, barad dur, barad, lego minifigure, The Lord of the Rings, lego the lord of the rings, sauron

Sauron, Dark Lord of Mordor and Lord of the Rings Star, Dead at... Hoo Boy

Mon, 03/25/2024 - 12:00
Gizmodo

This article was originally published on March 25, 2022. Happy Tolkien Reading Day!

Read more...

sauron, mordor, saruman, the return of the king, magic in middle earth, ring bearers, maia
Subscribe to mordor
sfy39587stp18