Skip to main content
Home
Toggle menu

  • Home

Mussolini


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

Mussolini

Here's Why UFOs Are Back in the News

Fri, 03/08/2024 - 18:25
Gizmodo : Politics

UFOs are back in the news this week with the release of a long-awaited Pentagon report that was designed to address public interest in the topic.

Read more...

david grusch ufo whistleblower claims, politics, all domain anomaly resolution office, investigation of ufo reports by the united states government, human interest, ross coulthart, Unidentified Flying Object

A tech boss appointed by Italy's prime minister resigned after quoting a speech from fascist dictator Mussolini in an internal email

Wed, 03/15/2023 - 08:41
Tech Insider
benito mussolino

AP Images

Tech Insider, Trending UK, Tech, Mussolini, benito mussolini, Italy
Subscribe to Mussolini
sfy39587stp18