Skip to main content
Home
Toggle menu

  • Home

eminent domain


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

eminent domain

A retired Georgia couple is fighting back against a railroad company that wants to take land their family has owned for generations

Sat, 05/13/2023 - 04:15
Tech Insider
Don and Sally Garrett holding a sign reading,
Don and Sally Garrett oppose Sandersville Railroad's plans.

Institute for Justice

Real Estate, News, Transportation, Railroads, eminent domain, Institute for Justice, Retired
Subscribe to eminent domain
sfy39587stp18