Skip to main content
Home
Toggle menu

  • Home

Institute for Justice


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

Institute for Justice

A retired Georgia couple is fighting back against a railroad company that wants to take land their family has owned for generations

Sat, 05/13/2023 - 04:15
Tech Insider
Don and Sally Garrett holding a sign reading,
Don and Sally Garrett oppose Sandersville Railroad's plans.

Institute for Justice

Real Estate, News, Transportation, Railroads, eminent domain, Institute for Justice, Retired

A South Carolina business owner was threatened with 'ruinous fines and jail time' after zoning laws were changed

Sun, 04/16/2023 - 10:45
Tech Insider
U-Hauls in Mauldin, South Carolina.
Rafael Chinchilla offered U-Hauls to rent from his tire yard.

Institute for Justice

Retail, News, Small Business Owner, U-Haul, Trucks, Trailers, Institute for Justice
Subscribe to Institute for Justice
sfy39587stp18