Skip to main content
Home
Toggle menu

  • Home

honey 2


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

honey 2

Peter Pan & Pinocchio Join Winnie-the-Pooh in Becoming Slasher Baddies

Sun, 05/19/2024 - 16:00
Gizmodo

Last year, a new horror franchise took flight with Pooh: Blood & Honey.

peter pan, pinocchio, winnie the pooh, winnie, hatter, teresa banham, the twisted childhood universe

Not Even the Public Domain Horror Knockoffs Can Escape Cinematic Universes

Mon, 03/18/2024 - 12:45
Gizmodo

Stand aside, Mickey Mouse slasher movie (Steamboat Willie Mickey version only): the team behind

films, draftuntitled jagged edge productions cinematic universe, itn studios, pinocchio, freddy, pooh, willie mickey

Updates From Monarch: Legacy of Monsters, Rick & Morty, and More

Mon, 11/06/2023 - 10:15
Gizmodo

Rebecca Sugar is open to returning to Steven Universe. J.J. Abrams’ Constantine series for DC and Max is no more. Plus, what’s to come as Fear the Walking Dead nears its end. To me, my spoilers!

Read more...

morty, deliria, Rick and Morty, winnie, killing faith, guy pearce, dewanda wise
Subscribe to honey 2
sfy39587stp18