Skip to main content
Home
Toggle menu

  • Home

the twisted childhood universe


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

the twisted childhood universe

Peter Pan & Pinocchio Join Winnie-the-Pooh in Becoming Slasher Baddies

Sun, 05/19/2024 - 16:00
Gizmodo

Last year, a new horror franchise took flight with Pooh: Blood & Honey.

peter pan, pinocchio, winnie the pooh, winnie, hatter, teresa banham, the twisted childhood universe

Mickey Mouse Will Fight Winnie the Pooh in the Latest Public-Domain Horror Extravaganza

Wed, 05/01/2024 - 17:40
Gizmodo

It was inevitable, really: as soon as beloved childhood characters became fair game under public domain, they’d be

winnie, winnie the pooh, Mickey Mouse, the twisted childhood universe, films, entertainment culture, works based on a copyright free mickey mouse

Oh Deer, the Poohniverse Is Already Expanding

Wed, 04/03/2024 - 12:20
Gizmodo

Of all the public domain woodland and fairy-tale creatures that are part of Winnie-the-Pooh: Blood and Honey’s ever-expanding

white tailed deer, Honey, roe deer, winnie the pooh blood and honey 2, jason voorhees, winnie the pooh blood and honey, bambi
Subscribe to the twisted childhood universe
sfy39587stp18