Skip to main content
Home
Toggle menu

  • Home

horror-movies


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

horror-movies

The terrifying true stories that inspired your favorite horror movies

Sat, 10/12/2024 - 09:35
Tech Insider
the conjuring
"The Conjuring.”

Warner Bros.

Entertainment, Features, true-crime, horror-movies, classic-films, evergreen-content, horror

Florida 4th graders chose a violent unrated 'Winnie the Pooh' slasher film for movie day. Now parents are angry that the teacher agreed to show it.

Thu, 10/12/2023 - 16:27
Tech Insider
Press conference on the movie 'Winnie The Pooh Blood and Honey' at Alboa on January 24, 2023 in Mexico City, Mexico.
A press conference for 'Winnie The Pooh Blood and Honey.'

Medios y Media/Getty Images

Education, News, insider-news, winnie-the-pooh, public-domain, Education, school
Subscribe to horror-movies
sfy39587stp18