Skip to main content
Home
Toggle menu

  • Home

public-domain


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

public-domain

A 1920s version of Mickey Mouse is now in the public domain as Disney loses its decadeslong battle against the move

Mon, 01/01/2024 - 09:29
Tech Insider
side-by-side of Steamboat Willie Mickey cartoon and modern-day Mickey mascot
"Steamboat Willie" Mickey Mouse (left) and modern-day Mickey (right).

LMPC, picture alliance/Getty Images

Media, news-uk, disney, mickey-mouse, public-domain, Media, copyright

Florida 4th graders chose a violent unrated 'Winnie the Pooh' slasher film for movie day. Now parents are angry that the teacher agreed to show it.

Thu, 10/12/2023 - 16:27
Tech Insider
Press conference on the movie 'Winnie The Pooh Blood and Honey' at Alboa on January 24, 2023 in Mexico City, Mexico.
A press conference for 'Winnie The Pooh Blood and Honey.'

Medios y Media/Getty Images

Education, News, insider-news, winnie-the-pooh, public-domain, Education, school
Subscribe to public-domain
sfy39587stp18