Skip to main content
Home
Toggle menu

  • Home

jennifer jenkins


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

jennifer jenkins

The OG Mickey Mouse Finally Hits the Public Domain Next Week

Sun, 12/24/2023 - 10:30
Gizmodo

January 1, 2024 won’t just be the start of a new year. It’ll also see Mickey and Minnie Mouse enter the public domain.

Mickey Mouse, mickey, mouse, public domain day, entertainment culture, winnie the pooh, minnie mouse
Subscribe to jennifer jenkins
sfy39587stp18