Skip to main content
Home
Toggle menu

  • Home

public domain day


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

public domain day

Everything You Need to Know About Mickey Mouse's Public Domain Debut Today

Mon, 01/01/2024 - 16:00
Gizmodo

Mickey Mouse is finally in the hands of the public, to do whatever they want with him. Well, in part.

public domain, Mickey Mouse, disney, films, public domain day, winnie, entertainment culture

The OG Mickey Mouse Finally Hits the Public Domain Next Week

Sun, 12/24/2023 - 10:30
Gizmodo

January 1, 2024 won’t just be the start of a new year. It’ll also see Mickey and Minnie Mouse enter the public domain.

Mickey Mouse, mickey, mouse, public domain day, entertainment culture, winnie the pooh, minnie mouse
Subscribe to public domain day
sfy39587stp18