Skip to main content
Home
Toggle menu

  • Home

meat substitute


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

meat substitute

A company says it added mammoth DNA to plant-based burgers and that they tasted much more 'intense' and 'meatier' than the cow version

Thu, 04/06/2023 - 20:38
Tech Insider
Tube in a lab; a reconstructions of a woolly mammoth
Paleo uses precise fermentation to produce myoglobin, a protein found in meat.

Paleo; Andreas Arnold/picture alliance/Getty Images

Science, Woolly Mammoth, meat substitute, lab-grown meat, mammoth meatball, Alternative Meat, meat industry
Subscribe to meat substitute
sfy39587stp18