Skip to main content
Home
Toggle menu

  • Home

pesticides


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

pesticides

Your Store-Bought Bug Sprays Are Useless Against the Roach Menace

Wed, 08/14/2024 - 10:00
Gizmodo

Bug Spray

health, cockroaches, Insects, pesticides, pests

Does Washing Produce Really Remove Pesticides?

Wed, 04/24/2024 - 07:00
Gizmodo

A recent analysis from advocacy organization Consumer Reports is the latest to highlight the potential threat of pesticides in our produce.

pesticides, environmental impact of pesticides, health medical pharma, pesticide incidents in the san joaquin valley, pesticide, Food Safety, pesticide residue

U.S. Produce Contains High Levels of Pesticides, Consumer Reports Finds

Thu, 04/18/2024 - 12:30
Gizmodo : Environment

Some of your favorite produce might be dicier to eat than assumed.

pesticides, circle of poison, Environment, michael hansen, pesticide, organic food, Food Safety

Strawberries still have the most pesticides of any American produce, a report says. Here are the 12 fruits and vegetables on the 2024 'Dirty Dozen' list.

Sat, 03/23/2024 - 08:16
Tech Insider
Grocer with strawberries, fruits, and vegetables.
Environmental Working Group published the 2024 Shopper's Guide to Pesticides in Produce.

Luis Alvarez/Getty Images

Food, News, health, Food, health, pesticides, us-food
Subscribe to pesticides
sfy39587stp18