Skip to main content
Home
Toggle menu

  • Home

Retired


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

Retired

I invested most of my salary for 7 years and had enough to retire at 29. My best tips: start young, take risks and don't settle in expensive cities.

Wed, 03/27/2024 - 06:14
Tech Insider
Daniel George traveling in Iceland.
Daniel George traveling in Iceland.

Courtesy of Daniel George

finance, as-told-to, contributor-2024, AI, Retired, fire

Meet the typical retiree: A married woman in her 70s living on $30,000 a year in Maine or Florida

Sun, 03/10/2024 - 04:51
Tech Insider : Economy, Economy
retired woman eating ice cream on the beach

Rawpixel/Getty Images

economy, finance, economy, Retirement, retirement-crisis, Retired, retirees

Just over half of Americans over the age of 65 are earning under $30,000 a year, and it shows how stark the retirement crisis is

Mon, 03/04/2024 - 10:45
Tech Insider : Economy, Economy
sad older man looking through the window in retirement

Westend61/Getty Images

economy, economy, Retirement, retirement-crisis, Retire, Retired, social-security

Meet the 'forgotten middle' of Americans over 75 about to face a rocky retirement

Tue, 02/20/2024 - 12:23
Tech Insider : Economy, Economy
retirees looking sad

Charday Penn/Getty Images

economy, economy, Retirement, retirement-crisis, Inequality, income-inequality, racial-inequality

The US Air Force is again letting retirees come back amid worries about recruiting and retention

Thu, 02/08/2024 - 13:35
Tech Insider
U.S. Air Force Tech. Sgt. Damian Dorsey, aircraft armament systems technician, from the 113th Aircraft Maintenance Squadron out of Washington D.C., conducts pre-flight procedures for an F-16 Fighting Falcon during Red Flag 23-3, at Nellis Air Force Base, Nevada, July 19, 2023.
U.S. Air Force Tech. Sgt.
Military & Defense, air-force, Recruiting, retention, pilots, Retired

I'm a widow who sold everything to move from Texas to Lake Como. I decided long ago that I wouldn't let fear dictate my life.

Tue, 01/23/2024 - 05:05
Tech Insider
a woman walking down a street in Italy
Judy Walling moved to Como in September.

Courtesy of Judy Walling

Real Estate, BI-freelancer, Italy, lake-como, Texas, Moving, Relocation

A retired Georgia couple is fighting back against a railroad company that wants to take land their family has owned for generations

Sat, 05/13/2023 - 04:15
Tech Insider
Don and Sally Garrett holding a sign reading,
Don and Sally Garrett oppose Sandersville Railroad's plans.

Institute for Justice

Real Estate, News, Transportation, Railroads, eminent domain, Institute for Justice, Retired

Meet a boomer who retired from a 6-figure job so he wouldn't have to work remotely full time

Sun, 05/07/2023 - 06:30
Tech Insider : Economy
Empty office

Getty Images

economy, Remote Work, remote working, Remote Workers, return to office, Retired, Early retirement

A baby boomer who quit his 6-figure job rather than return to the office says managers are threatened by remote work and just want people back so they can see them working

Sun, 04/16/2023 - 06:00
Tech Insider : Economy
man commuting to work in mask with laptop
Dennis (not pictured) liked the autonomy of full-time remote work.

Marko Geber/Getty Images

economy, Careers, return to office, Remote Work, Remote Workers, remote working, work remotely

Pagination

  • Previous page ‹‹
Subscribe to Retired
sfy39587stp18