Skip to main content
Home
Toggle menu

  • Home

simon phillips


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

simon phillips

Mickey Mouse Horror Movie Makers Are as Cynical as You'd Expect

Mon, 01/08/2024 - 15:15
Gizmodo

It was inevitable that once Mickey Mouse entered the public domain via early Disney short Steamboat Willie, projects exploiting the icon’s newly accessible status

Mickey Mouse, mickey, jamie bailey, alex, entertainment culture, winnie the pooh, mickey mouse trap
Subscribe to simon phillips
sfy39587stp18