Skip to main content
Home
Toggle menu

  • Home

tom mulheron


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

tom mulheron

Oh Deer, the Poohniverse Is Already Expanding

Wed, 04/03/2024 - 12:20
Gizmodo

Of all the public domain woodland and fairy-tale creatures that are part of Winnie-the-Pooh: Blood and Honey’s ever-expanding

white tailed deer, Honey, roe deer, winnie the pooh blood and honey 2, jason voorhees, winnie the pooh blood and honey, bambi
Subscribe to tom mulheron
sfy39587stp18