Skip to main content
Home
Toggle menu

  • Home

winnie the pooh blood and honey 2


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

winnie the pooh blood and honey 2

Peter Pan & Pinocchio Join Winnie-the-Pooh in Becoming Slasher Baddies

Sun, 05/19/2024 - 16:00
Gizmodo

Last year, a new horror franchise took flight with Pooh: Blood & Honey.

peter pan, pinocchio, winnie the pooh, winnie, hatter, teresa banham, the twisted childhood universe

Mickey Mouse Will Fight Winnie the Pooh in the Latest Public-Domain Horror Extravaganza

Wed, 05/01/2024 - 17:40
Gizmodo

It was inevitable, really: as soon as beloved childhood characters became fair game under public domain, they’d be

winnie, winnie the pooh, Mickey Mouse, the twisted childhood universe, films, entertainment culture, works based on a copyright free mickey mouse

Oh Deer, the Poohniverse Is Already Expanding

Wed, 04/03/2024 - 12:20
Gizmodo

Of all the public domain woodland and fairy-tale creatures that are part of Winnie-the-Pooh: Blood and Honey’s ever-expanding

white tailed deer, Honey, roe deer, winnie the pooh blood and honey 2, jason voorhees, winnie the pooh blood and honey, bambi

Not Even the Public Domain Horror Knockoffs Can Escape Cinematic Universes

Mon, 03/18/2024 - 12:45
Gizmodo

Stand aside, Mickey Mouse slasher movie (Steamboat Willie Mickey version only): the team behind

films, draftuntitled jagged edge productions cinematic universe, itn studios, pinocchio, freddy, pooh, willie mickey
Subscribe to winnie the pooh blood and honey 2
sfy39587stp18