Skip to main content
Home
Toggle menu

  • Home

Landowners


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

Landowners

A Chinese gaming billionaire now ranks as one of the top landowners in the US

Wed, 01/10/2024 - 07:49
Tech Insider
Chen Tianqiao, Cofounder and Chief Executive Officer of Shanda Interactive Entertainment Limited, a Nasdaq-listed leading operator of online games, attends an economy elites award ceremony on February 28, 2005 in Shanghai, China.
Tianqiao Chen in 2005, the year after he took Shanda Interactive Entertainment public.

China Photos/Getty Images

Real Estate, real-estate, Oregon, trending-uk, Billionaire, Landowners, chinese-billionaire

A retired Georgia couple is fighting back against a railroad company that wants to take land their family has owned for generations

Sat, 05/13/2023 - 04:15
Tech Insider
Don and Sally Garrett holding a sign reading,
Don and Sally Garrett oppose Sandersville Railroad's plans.

Institute for Justice

Real Estate, News, Transportation, Railroads, eminent domain, Institute for Justice, Retired
Subscribe to Landowners
sfy39587stp18