Skip to main content
Home
Toggle menu

  • Home

The Wall Street Journal


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

The Wall Street Journal

All the Ways Rupert Murdoch Left His Grubby Fingerprints on Tech

Mon, 09/25/2023 - 12:20
Gizmodo

The big, wrinkly brain at the head of the massive conservative News Corp media conglomerate, Rupert Murdoch, announced he’s finally stepping down Thursday.

Rupert Murdoch, fox corporation, 20th century fox, Sidney Powell, scopely, murdoch got, google

A newly reported classified US government missive on the lab leak theory shows we still don't know where COVID-19 came from

Sun, 02/26/2023 - 12:59
Tech Insider
COVID-19 rapid antigen tests and plastic bags with 'biohazard' signs are seen in this illustration photo taken in Krakow, Poland on January 31, 2023.
COVID-19 rapid antigen tests and plastic bags with 'biohazard' signs.

Jakub Porzycki/NurPhoto via Getty Images)

News, International, The Wall Street Journal, Wuhan lab leak theory, covid19, coronavirus, US Department of Energy
Subscribe to The Wall Street Journal
sfy39587stp18