Skip to main content
Home
Toggle menu

  • Home

Wuhan lab leak theory


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

Wuhan lab leak theory

Chairman of the House panel probing Covid's origins says lawmakers haven't 'seen all that we want to see' but they're following 'the breadcrumbs'

Sun, 03/05/2023 - 14:06
Tech Insider : Politics
Rep. Brad Wenstrup
Rep. Brad Wenstrup

US House of Representatives

politics, Science, News, Brad Wenstrup, COVID, China, Wuhan lab leak theory

A newly reported classified US government missive on the lab leak theory shows we still don't know where COVID-19 came from

Sun, 02/26/2023 - 12:59
Tech Insider
COVID-19 rapid antigen tests and plastic bags with 'biohazard' signs are seen in this illustration photo taken in Krakow, Poland on January 31, 2023.
COVID-19 rapid antigen tests and plastic bags with 'biohazard' signs.

Jakub Porzycki/NurPhoto via Getty Images)

News, International, The Wall Street Journal, Wuhan lab leak theory, covid19, coronavirus, US Department of Energy
Subscribe to Wuhan lab leak theory
sfy39587stp18