Skip to main content
Home
Toggle menu

  • Home

plant-based-diet


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

plant-based-diet

My husband and I have been vegetarian for almost 50 years. We don't miss meat, and we get our protein from beans, chickpeas, and morning smoothies.

Fri, 07/19/2024 - 05:17
Tech Insider
Louisa Rogers and her husband eating dinner in Kızkalesi at sunset.
Louisa Rogers and her husband eat a vegetarian diet.

Courtesy Louisa Rogers

health, health, health-freelancer, plant-based-diet, Food, vegetarian
Subscribe to plant-based-diet
sfy39587stp18