Skip to main content
Home
Toggle menu

  • Home

vegetarian


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

vegetarian

I've worked at Costco for 18 years. From plant-based chicken nuggets to kimbap, here are 8 of the best vegetarian meals to get there.

Tue, 08/27/2024 - 11:36
Tech Insider
A hand holding a yellow and blue container of edamame with images of edamame pods on the front
Costco carries plenty of tasty vegetarian items.

Veronica Thatcher

Food, Food, vegetarian, vegetarian-diet, Costco, costco-employee, costco-shoppers

My husband and I have been vegetarian for almost 50 years. We don't miss meat, and we get our protein from beans, chickpeas, and morning smoothies.

Fri, 07/19/2024 - 05:17
Tech Insider
Louisa Rogers and her husband eating dinner in Kızkalesi at sunset.
Louisa Rogers and her husband eat a vegetarian diet.

Courtesy Louisa Rogers

health, health, health-freelancer, plant-based-diet, Food, vegetarian

McDonald's trialed the McPlant in California and Texas. It failed because people don't want a meat-free burger from the Golden Arches.

Thu, 06/27/2024 - 06:25
Tech Insider
In this photo illustration, packaging for the McDonald's McPlant Beyond Meat burger is displayed with French Fries at a McDonald's restaurant on February 14, 2022 in San Rafael, California.
You won't see the McPlant on McDonald's US menus anytime soon.

Justin Sullivan/Getty Images

Retail, Food, McDonalds, mcplant, restaurants, fast-food, meat
Subscribe to vegetarian
sfy39587stp18