Skip to main content
Home
Toggle menu

  • Home

starting-a-business


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

starting-a-business

I launched an eCommerce company with a $10,000 budget after interviewing top Amazon sellers. Here's everything I outsourced to save time, including a $250 task that was the best money I spent.

Sat, 11/30/2024 - 07:14
Tech Insider : Business
peak pickleball
The author and her cofounder launched Peak Pickleball with a $10,000 budget.

Katie Monds

Investing, limited-synd, eCommerce, starting-a-business, pickleball, entrepeneurs

Gen Z is going to rule the business world sooner than you think

Mon, 03/25/2024 - 05:39
Tech Insider : Economy
A shopping cart full of the ingredients needed to start a business
With just an idea, a domain name, and a dream, Gen Z has everything it needs to take over the business marketplace.

Daniel Jurman for BI

economy, Small Business, Careers, Startups, gen-z, Entrepreneurs, Entrepreneurship

3 small-business owners share the unconventional ways they funded their companies, from credit cards to tax credits

Tue, 09/26/2023 - 12:03
Tech Insider
Headshot of Elizabeth Gore sitting behind a desk with pencils and a computer in the background
Elizabeth Gore, president and cofounder of Hello Alice.

Cayce Clifford

Small Business, sp-spectrum-smb, Funding, small-business-owners, small-business, credit-card-benefits, starting-a-business
Subscribe to starting-a-business
sfy39587stp18