Skip to main content
Home
Toggle menu

  • Home

nurtition


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

nurtition

A nutritionist who cut down on ultra-processed foods quit protein shakes and bars. Here are 3 things he would eat after a workout instead.

Thu, 08/01/2024 - 08:13
Tech Insider
A composite image. On the left roasted chickpeas, seasoned with spices, in a white bowl are pictured. On the right, Rob Hobson is wearing a denim shirt and looking to the left.
Nutritionist Rob Hobson makes his own high-protein snacks from scratch.

Getty Images/ Rob Hobson

health, nurtition, ultra-processed-foods, Diet, workout-snacks, Protein, protein-bars
Subscribe to nurtition
sfy39587stp18