Skip to main content
Home
Toggle menu

  • Home

usa-rugby


  1. arsenaultriveradanaschwartztarasimphilszostaksuzannewalkerhannahwhittenfranwildeseanwilliamsalyssawong
  2. Page not found

usa-rugby

Alev Kelter helped the US win its first medal in rugby. She prepared with protein, saunas, and vulnerable talks with her teammates.

Wed, 07/31/2024 - 13:18
Tech Insider
Composite image showcasing Olympic American rugby player Alev Kelter, with a headshot alongside an action shot of  Kelter running with rugby ball

Courtesy of USA Rugby; BI

health, road-to-paris, Olympics, usa-rugby, olympic-athletes, Fitness, exercise
Subscribe to usa-rugby
sfy39587stp18